IGFBP2 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.

Description:
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2 (IGFBP2) detection. Tested with WB in Human, Rat.

Synonyms:
BP 2 antibody, BP2 antibody, IBP 2 antibody, IBP-2 antibody, IBP2 antibody, IBP2_HUMAN antibody, IGF binding protein 2 antibody, IGF BP53 antibody, IGF-binding protein 2 antibody, IGFBP 2 antibody, IGFBP-2 antibody, IGFBP2 antibody, IGFBP53 antibody, Insulin like growth factor binding protein 2 36kDa antibody, Insulin like growth factor binding protein 2 antibody, Insulin like growth factor-binding protein 2 precursor antibody, Insulin-like growth factor-binding protein 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.