IGFBP3 polyclonal, anti-human, rat

IGFBP3 polyclonal, anti-human, rat

€384.00
In stock
SKU
ARP-10-P9710
Catalog Number: 10-P9710
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Description:
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3 (IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human, Rat.

Synonyms:
Acid stable subunit of the 140 K IGF complex antibody, Binding protein 29 antibody, Binding protein 53 antibody, BP 53 antibody, BP53 antibody, Growth hormone dependent binding protein antibody, IBP 3 antibody, IBP-3 antibody, IBP3 antibody, IBP3_HUMAN antibody, IGF binding protein 3 antibody, IGF-binding protein 3 antibody, IGFBP 3 antibody, IGFBP-3 antibody, IGFBP3 antibody, Insulin Like Growth Factor Binding Protein 3 antibody, Insulin-like growth factor-binding protein 3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB, IHC-P, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IGFBP3 polyclonal, anti-human, rat