Ikaros polyclonal, anti-human, mouse, rat

Ikaros polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9643
Catalog Number: 10-P9643
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

Description:
Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros (IKZF1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
CLL associated antigen KW 6 antibody, DNA-binding protein Ikaros antibody, hIk 1 antibody, Hs.54452 antibody, IK1 antibody, Ikaros (zinc finger protein) antibody, IKAROS antibody, IKAROS family zinc finger 1 (Ikaros) antibody, Ikaros family zinc finger protein 1 antibody, Ikzf1 antibody, IKZF1_HUMAN antibody, LYF1 antibody, Lymphoid transcription factor LyF-1 antibody, PRO0758 antibody, Zinc finger protein subfamily 1A 1 (Ikaros) antibody, Zinc finger protein subfamily 1A 1 antibody, Zinc finger protein, subfamily 1A, member 1 antibody, ZNFN1A1 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Ikaros polyclonal, anti-human, mouse, rat