IL-12 alpha human active recombinant protein

Protein Family: Cytokines

Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System

Alternate Names: IL-12 alpha, Interleukin-12 subunit alpha, IL-12A, Cytotoxic lymphocyte maturation factor 35 kDa subunit, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1Description:
Interleukin-12 p35 is a cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. Recombinant interleukin-12 p35 comprises a 197 amino acid fragment (57-253) corresponding to the mature Interleukin-12 p35 chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P29459

MW: 27.04 kDa

Sequence:
His-Tag sequence not included: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.