IL1RA Picoband polyclonal, anti-mouse antibody

IL1RA Picoband polyclonal, anti-mouse antibody

€270.00
In stock
SKU
AC-ABO12871
Catalog Number: AC-ABO12871
Size: 100 µg
Host: rabbit IgG
Applications: WB, E
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for FBXL11 detection. Tested with WB in human, mouse, rat.

Background:
Histone demethylase that specifically demethylates 'Lys- 36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys- 36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis.

Other Names:
Lysine-specific demethylase 2A, 1.14.11.27, CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, JmjC domain-containing histone demethylation protein 1A, [Histone-H3]-lysine-36 demethylase 1A, KDM2A, CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004

Subcellular Localization: Nucleus, nucleoplasm.

Tissue Specificity: Widely expressed, with highest levels in brain, testis and ovary, followed by lung.

Gene ID: 22992

Immunogen: A synthetic peptide corresponding to a sequence of human FBXL11 (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR).

Calculated MW: 132793

Format: Lyophilized

Contents: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IL1RA Picoband polyclonal, anti-mouse antibody