IL6R Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12947
Catalog Number: AC-ABO12947
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.
Protein Function:
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Other Names: Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, CD126, IL6R
Subcellular Localization: Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein.
Tissue Specificity: Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
Gene ID: 3570
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).
Calculated MW: 51548
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Other Names: Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, CD126, IL6R
Subcellular Localization: Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein.
Tissue Specificity: Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
Gene ID: 3570
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).
Calculated MW: 51548
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review