IL7R/CD127 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12633
Catalog Number: AC-ABO12633
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human;Rat.Protein Name: Interleukin-7 receptor subunit alpha
Protein Function:
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Other Names: Interleukin-7 receptor subunit alpha, IL-7 receptor subunit alpha, IL-7R subunit alpha, IL-7R-alpha, IL-7RA, CDw127, CD127, IL7R
Subcellular Localization: Isoform 1: Cell membrane; Single-pass type I membrane protein.
Gene ID: 3575
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Calculated MW: 51579
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Other Names: Interleukin-7 receptor subunit alpha, IL-7 receptor subunit alpha, IL-7R subunit alpha, IL-7R-alpha, IL-7RA, CDw127, CD127, IL7R
Subcellular Localization: Isoform 1: Cell membrane; Single-pass type I membrane protein.
Gene ID: 3575
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Calculated MW: 51579
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review