ING1 polyclonal, anti-human

Quantity: 100 µg

Background:
Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Description:
Rabbit IgG polyclonal antibody for Inhibitor of growth protein 1 (ING1) detection. Tested with WB in Human.

Synonyms:
2610028J21Rik antibody, AA407184 antibody, AI875420 antibody, Growth inhibitor ING 1 antibody, Growth inhibitor ING1 antibody, Growth inhibitory protein ING 1 antibody, Growth inhibitory protein ING1 antibody, Homo sapiens growth inhibitor p33ING1 (ING1) mRNA, complete cds antibody, ING 1 antibody, Ing1 antibody, ING1_HUMAN antibody, Inhibitor of growth 1 antibody, Inhibitor of growth family member 1 antibody, Inhibitor of growth protein 1 antibody, mING1h antibody, OTTHUMP00000018703 antibody, OTTHUMP00000018704 antibody, OTTHUMP00000018705 antibody, OTTHUMP00000018706 antibody, p24ING1c antibody, p33 antibody, p33 ING1 antibody, p33ING1 antibody, p33ING1b antibody, p33ING1c antibody, p37Ing1b antibody, p47 antibody, p47ING1a antibody, Tumor suppressor ING 1 antibody, Tumor suppressor ING1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.