iNOS Picoband polyclonal, anti-human

Description: Rabbit IgG polyclonal antibody for Nitric oxide synthase, inducible(NOS2) detection. Tested with WB in Human.Protein Name: Nitric oxide synthase, inducible

Protein Function:
Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such COX2. As component of the iNOS- S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys- 247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM. .

Other Names: Nitric oxide synthase, inducible, 1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase, Inducible NOS, iNOS, NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2, NOS2A

Tissue Specificity: Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets.

Gene ID: 4843

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS (1088-1126aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Calculated MW: 131117

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.