Integrin Alpha 3 polyclonal, anti-human, mouse, rat antibody

Integrin Alpha 3 polyclonal, anti-human, mouse, rat antibody

€310.00
In stock
SKU
AC-ABO10935
Catalog Number: AC-ABO10935
Size: 100 µg
Host: rabbit IgG
Applications: WB, IHC-P
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Fascin (FSCN1) detection. Tested with WB in human, rat.

Protein Name: Fascin

Background:
Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. .

Other Names:
Fascin, 55 kDa actin-bundling protein, Singed-like protein, p55, FSCN1, FAN1, HSN, SNL

Subcellular Localization: Cytoplasm, cytoskeleton. Cell projection, filopodium. Cell projection, invadopodium. Cytoplasm, cytosol. In glioma cells, partially colocalizes with F-actin stress fibers in the cytosol.

Tissue Specificity: Ubiquitous.

Gene ID: 6624

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Calculated MW: 54530

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Integrin Alpha 3 polyclonal, anti-human, mouse, rat antibody