Integrin alpha 3A (clone 29A3), anti-human
€564.00
In stock
SKU
ARP-21-5180
Catalog Number: 21-5180
Size: 100 µg
Isotype: Mouse IgG1
Size: 100 µg
Isotype: Mouse IgG1
Background:
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Clone: 29A3
Isotype: Mouse IgG1
Source: 29A3 is a Mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Reactivity: human. A broad species reactivity is expected because of the conserved nature of the epitope.
Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
Form: Each vial contains 100ul purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applications: Immunocytochemistry, Immunohistochemistry (frozen), Western blotting
Storage: Store at 4C, or in small aliquots at -20C.
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Clone: 29A3
Isotype: Mouse IgG1
Source: 29A3 is a Mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Reactivity: human. A broad species reactivity is expected because of the conserved nature of the epitope.
Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
Form: Each vial contains 100ul purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applications: Immunocytochemistry, Immunohistochemistry (frozen), Western blotting
Storage: Store at 4C, or in small aliquots at -20C.
| Is Featured? | No |
|---|
Write Your Own Review