Involucrin Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12398
Catalog Number: AC-ABO12398
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.Protein Name: Involucrin
Protein Function:
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Other Names: Involucrin, IVL
Subcellular Localization: Cytoplasm. Constituent of the scaffolding of the cornified envelope.
Tissue Specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
Gene ID: 3713
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Calculated MW: 68479
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Other Names: Involucrin, IVL
Subcellular Localization: Cytoplasm. Constituent of the scaffolding of the cornified envelope.
Tissue Specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
Gene ID: 3713
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Calculated MW: 68479
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review