Involucrin polyclonal, anti-human

Quantity: 100 µg

Background:
Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath theplasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by thetransglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

Description:
Rabbit IgG polyclonal antibody for Involucrin (IVL) detection. Tested with WB in Human.

Synonyms:
INVO_HUMAN antibody, Involucrin antibody, IVL antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.