ITK Picoband polyclonal, anti-human, mouse antibody
€270.00
In stock
SKU
AC-ABO10179
Description: Rabbit IgG polyclonal antibody for Annexin A7 (ANXA7) detection. Tested with WB in human.
Protein Name: Annexin A7
Background:
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Other Names:
Annexin A7, Annexin VII, Annexin-7, Synexin, ANXA7, ANX7, SNX
Subcellular Localization:
Tissue Specificity: Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. .
Gene ID: 310
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.
Calculated MW: 52739
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Annexin A7
Background:
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Other Names:
Annexin A7, Annexin VII, Annexin-7, Synexin, ANXA7, ANX7, SNX
Subcellular Localization:
Tissue Specificity: Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. .
Gene ID: 310
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.
Calculated MW: 52739
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review