JAK1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10058
Catalog Number: AC-ABO10058
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase JAK1(JAK1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Tyrosine-protein kinase JAK1
Protein Function:
Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. .
Other Names: Tyrosine-protein kinase JAK1, 2.7.10.2, Janus kinase 1, JAK-1, JAK1, JAK1A, JAK1B
Subcellular Localization: Endomembrane system; Peripheral membrane protein. Wholly intracellular, possibly membrane associated.
Tissue Specificity: Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue. .
Gene ID: 3716
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.
Calculated MW: 133277
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. .
Other Names: Tyrosine-protein kinase JAK1, 2.7.10.2, Janus kinase 1, JAK-1, JAK1, JAK1A, JAK1B
Subcellular Localization: Endomembrane system; Peripheral membrane protein. Wholly intracellular, possibly membrane associated.
Tissue Specificity: Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue. .
Gene ID: 3716
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.
Calculated MW: 133277
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review