JAK1 polyclonal, anti-human, mouse, rat antibody
€270.00
In stock
SKU
AC-ABO10942
Description: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, heart (FABP3) detection. Tested with WB, IHC-P in human, mouse, rat.
Protein Name: Fatty acid-binding protein, heart
Background:
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Other Names:
Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Heart-type fatty acid-binding protein, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP3, FABP11, MDGI
Subcellular Localization: Cytoplasm.
Gene ID: 2170
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.
Calculated MW: 14858
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Fatty acid-binding protein, heart
Background:
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Other Names:
Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Heart-type fatty acid-binding protein, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP3, FABP11, MDGI
Subcellular Localization: Cytoplasm.
Gene ID: 2170
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.
Calculated MW: 14858
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review