JNK2 polyclonal, anti-human

Quantity: 100 µg

Background:
JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Description:
Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9 (MAPK9) detection. Tested with WB in Human.

Synonyms:
c Jun kinase 2 antibody, C Jun N terminal kinase 2 antibody, c-Jun N-terminal kinase 2 antibody, JNK 55 antibody, JNK-55 antibody, JNK2 alpha antibody, JNK2 antibody, JNK2 beta antibody, JNK2A antibody, JNK2alpha antibody, JNK2B antibody, JNK2BETA antibody, Jun kinase antibody, MAP kinase 9 antibody, MAPK 9 antibody, Mapk9 antibody, Mitogen activated protein kinase 9 antibody, Mitogen-activated protein kinase 9 antibody, MK09_HUMAN antibody, P54a antibody, p54aSAPK antibody, PRKM9 antibody, SAPK alpha antibody, SAPK antibody, SAPK1a antibody, Stress activated protein kinase 1a antibody, Stress-activated protein kinase JNK2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.