KAT13D/CLOCK polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Clock (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.

Description:
Rabbit IgG polyclonal antibody for Circadian locomoter output cycles protein kaput (CLOCK) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
bHLHe8 antibody, Circadian locomoter output cycles kaput protein antibody, Circadian locomoter output cycles protein kaput antibody, Circadian Locomotor Output Cycles Kaput antibody, Circadium Locomotor Output Cycles Kaput antibody, Class E basic helix-loop-helix protein 8 antibody, CLOCK antibody, Clock circadian regulator antibody, Clock homolog antibody, Clock protein antibody, CLOCK_HUMAN antibody, hCLOCK antibody, KIAA0334 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.