KChIP2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12338
Catalog Number: AC-ABO12338
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Kv channel-interacting protein 2
Protein Function:
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart (By similarity). .
Other Names: Kv channel-interacting protein 2, KChIP2, A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, Potassium channel-interacting protein 2, KCNIP2, KCHIP2
Subcellular Localization: Isoform 1: Cell membrane ; Lipid-anchor . Detected on lipid rafts (By similarity). .
Tissue Specificity: Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart. .
Gene ID: 30819
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 30907
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart (By similarity). .
Other Names: Kv channel-interacting protein 2, KChIP2, A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, Potassium channel-interacting protein 2, KCNIP2, KCHIP2
Subcellular Localization: Isoform 1: Cell membrane ; Lipid-anchor . Detected on lipid rafts (By similarity). .
Tissue Specificity: Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart. .
Gene ID: 30819
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 30907
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review