KChIP2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Description:
Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2 (KCNIP2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
A type potassium channel modulatory protein 2 antibody, A-type potassium channel modulatory protein 2 antibody, Cardiac voltage gated potassium channel modulatory subunit antibody, Cardiac voltage-gated potassium channel modulatory subunit antibody, DKFZp566L1246 antibody, KChIP 2 antibody, KChIP2 antibody, KCIP2_HUMAN antibody, KCNIP 2 antibody, Kcnip2 antibody, Kv channel interacting protein 2 antibody, Kv channel-interacting protein 2 antibody, MGC17241 antibody, Potassium channel interacting protein 2 antibody, Potassium channel-interacting protein 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.