KCNA3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12336
Catalog Number: AC-ABO12336
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Potassium voltage-gated channel subfamily A member 3
Protein Function:
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Other Names: Potassium voltage-gated channel subfamily A member 3, HGK5, HLK3, HPCN3, Voltage-gated K(+) channel HuKIII, Voltage-gated potassium channel subunit Kv1.3, KCNA3, HGK5
Subcellular Localization: Cell membrane ; Multi-pass membrane protein.
Gene ID: 3738
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
Calculated MW: 63842
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Other Names: Potassium voltage-gated channel subfamily A member 3, HGK5, HLK3, HPCN3, Voltage-gated K(+) channel HuKIII, Voltage-gated potassium channel subunit Kv1.3, KCNA3, HGK5
Subcellular Localization: Cell membrane ; Multi-pass membrane protein.
Gene ID: 3738
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
Calculated MW: 63842
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review