KCNA3 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

Description:
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3 (KCNA3) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
HGK 5 antibody, HGK5 antibody, HLK 3 antibody, HLK3 antibody, HPCN 3 antibody, HPCN3 antibody, HuKIII antibody, KCNA 3 antibody, Kcna3 antibody, KCNA3_HUMAN antibody, KV1.3 antibody, MK 3 antibody, MK3 antibody, OTTHUMP00000032397 antibody, PCN 3 antibody, PCN3 antibody, Potassium channel 3 antibody, Potassium voltage gated channel shaker related subfamily member 3 antibody, Potassium voltage gated channel subfamily A member 3 antibody, Potassium voltage-gated channel subfamily A member 3 antibody, Type n potassium channel antibody, Voltage gated potassium channel protein Kv1.3 antibody, Voltage gated potassium channel subunit Kv1.3 antibody, Voltage-gated K(+) channel HuKIII antibody, Voltage-gated potassium channel subunit Kv1.3 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.