KCNH1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10137
Catalog Number: AC-ABO10137
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for KCNH1 detection. Tested with WB in Human;Mouse;Rat.
Protein Function:
Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed:9738473, PubMed:11943152, PubMed:10880439, PubMed:22732247, PubMed:25556795, PubMed:27325704, PubMed:27005320, PubMed:27618660). Channel properties are modulated by subunit assembly (PubMed:11943152). Mediates IK(NI) current in myoblasts (PubMed:9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed:23881642).
Other Names: Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1, EAG channel 1, h-eag, hEAG1, Voltage-gated potassium channel subunit Kv10.1, KCNH1
Subcellular Localization: Cell membrane.
Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
Gene ID: 3756
Immunogen: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
Calculated MW: 111423
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed:9738473, PubMed:11943152, PubMed:10880439, PubMed:22732247, PubMed:25556795, PubMed:27325704, PubMed:27005320, PubMed:27618660). Channel properties are modulated by subunit assembly (PubMed:11943152). Mediates IK(NI) current in myoblasts (PubMed:9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed:23881642).
Other Names: Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1, EAG channel 1, h-eag, hEAG1, Voltage-gated potassium channel subunit Kv10.1, KCNH1
Subcellular Localization: Cell membrane.
Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
Gene ID: 3756
Immunogen: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
Calculated MW: 111423
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review