Keratocan Picoband polyclonal, anti-human, mouse
€455.00
In stock
SKU
AC-ABO12339
Catalog Number: AC-ABO12339
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human;Mouse.Protein Name: Keratocan
Protein Function:
May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix.
Other Names: Keratocan, KTN, Keratan sulfate proteoglycan keratocan, KERA, SLRR2B
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Tissue Specificity: Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen. .
Gene ID: 11081
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.
Calculated MW: 40509
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix.
Other Names: Keratocan, KTN, Keratan sulfate proteoglycan keratocan, KERA, SLRR2B
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Tissue Specificity: Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen. .
Gene ID: 11081
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.
Calculated MW: 40509
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review