KIAA0652 polyclonal, anti-human, mouse

Quantity: 100 µg

Background:
Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.

Description:
Rabbit IgG polyclonal antibody for Autophagy-related protein 13 (ATG13) detection. Tested with WB in Human, Mouse.

Synonyms:
ATG13 antibody, ATG13 autophagy related 13 homolog (S. cerevisiae) antibody, ATG13_HUMAN antibody, Autophagy related 13 antibody, Autophagy related protein 13 antibody, Autophagy-related protein 13 antibody, FLJ20698 antibody, KIAA0652 antibody, OTTHUMP00000233321 antibody, OTTHUMP00000233322 antibody, OTTHUMP00000233323 antibody, OTTHUMP00000233324 antibody, OTTHUMP00000233325 antibody, OTTHUMP00000233326 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.