KIM1 polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12770
Catalog Number: AC-ABO12770
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVCR1) detection. Tested with WB in Human.Protein Name: Hepatitis A virus cellular receptor 1
Protein Function:
May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair. .
Other Names: Hepatitis A virus cellular receptor 1, HAVcr-1, Kidney injury molecule 1, KIM-1, T-cell immunoglobulin and mucin domain-containing protein 1, TIMD-1, T-cell immunoglobulin mucin receptor 1, TIM, TIM-1, T-cell membrane protein 1, HAVCR1, KIM1, TIM1, TIMD1
Subcellular Localization: Membrane ; Single-pass type I membrane protein .
Tissue Specificity: Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses. .
Gene ID: 26762
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Calculated MW: 39250
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair. .
Other Names: Hepatitis A virus cellular receptor 1, HAVcr-1, Kidney injury molecule 1, KIM-1, T-cell immunoglobulin and mucin domain-containing protein 1, TIMD-1, T-cell immunoglobulin mucin receptor 1, TIM, TIM-1, T-cell membrane protein 1, HAVCR1, KIM1, TIM1, TIMD1
Subcellular Localization: Membrane ; Single-pass type I membrane protein .
Tissue Specificity: Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses. .
Gene ID: 26762
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Calculated MW: 39250
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review