Kininogen 1 polyclonal, anti-mouse

Quantity: 100 µg

Background:
Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins – high – molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.

Description:
Rabbit IgG polyclonal antibody for Kininogen-1 (KNG1) detection. Tested with WB, IHC-P in Mouse.

Synonyms:
Alpha-2-thiol proteinase inhibitor antibody, BDK antibody, BK antibody, Bradykinin antibody, Fitzgerald factor antibody, High molecular weight kininogen antibody, HMWK antibody, Ile-Ser-Bradykinin antibody, Kallidin I antibody, Kallidin II antibody, Kininogen antibody, KNG antibody, KNG1 antibody, KNG1_HUMAN antibody, Low molecular weight growth-promoting factor antibody, Williams-Fitzgerald-Flaujeac factor antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.