Ku70 polyclonal, anti-human

Quantity: 100 µg

Background:
XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Description:
Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6 (XRCC6) detection. Tested with WB, IHC-P in Human.

Synonyms:
5''-deoxyribose-5-phosphate lyase Ku70 antibody, 5''-dRP lyase Ku70 antibody, 70 kDa subunit of Ku antigen antibody, ATP dependent DNA helicase 2 subunit 1 antibody, ATP dependent DNA helicase II 70 kDa subunit antibody, ATP-dependent DNA helicase 2 subunit 1 antibody, ATP-dependent DNA helicase II 70 kDa subunit antibody, CTC box binding factor 75 kDa subunit antibody, CTC box-binding factor 75 kDa subunit antibody, CTC75 antibody, CTCBF antibody, DNA repair protein XRCC6 antibody, G22P1 antibody, Ku 70 antibody, Ku autoantigen 70kDa antibody, Ku autoantigen p70 subunit antibody, Ku autoantigen, 70kDa antibody, Ku p70 antibody, Ku70 antibody, Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody, Kup70 antibody, Lupus Ku autoantigen protein p70 antibody, ML8 antibody, Thyroid autoantigen 70kD (Ku antigen) antibody, Thyroid autoantigen antibody, Thyroid lupus autoantigen antibody, Thyroid lupus autoantigen p70 antibody, Thyroid-lupus autoantigen antibody, TLAA antibody, X ray repair complementing defective repair in Chinese hamster cells 6 antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 antibody, X-ray repair cross-complementing protein 6 antibody, XRCC 6 antibody, XRCC6 antibody, XRCC6_HUMAN antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.