Kv1.2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

Description:
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2 (KCNA2) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Akr6a4 antibody, BK2 antibody, HBK5 antibody, HK4 antibody, HUKIV antibody, Kca1 2 antibody, kcna2 antibody, KV1.2 antibody, MGC50217 antibody, Mk 2 antibody, MK2 antibody, NGK1 antibody, Potassium voltage gated channel shaker related subfamily member 2 antibody, Potassium voltage-gated channel subfamily A member 2 antibody, RBK2 antibody, Voltage gated potassium channel subunit Kv1.2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.