Kv1.4 polyclonal, anti-human

Quantity: 100 µg

Background:
Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

Description:
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4 (KCNA4) detection. Tested with WB, IHC-P in Human.

Synonyms:
Voltage gated K+ channel HuKII antibody, cardiac potassium channel antibody, fetal skeletal muscle potassium channel antibody, HBK 4 antibody, HBK4 antibody, HK 1 antibody, HK1 antibody, HPCN 2 antibody, HPCN2 antibody, HUK II antibody, HUKII antibody, KCNA 4 antibody, KCNA 8 antibody, KCNA4 antibody, KCNA4_HUMAN antibody, KCNA4L antibody, KCNA8 antibody, kv1.4 antibody, PCN 2 antibody, PCN2 antibody, potassium channel 2 antibody, potassium channel KCNA4 antibody, potassium channel protein antibody, Potassium voltage gated channel shaker related subfamily member 4 antibody, Potassium voltage gated channel subfamily A member 4 antibody, potassium voltage-gated channel shaker-related subfamily member 4-like antibody, Potassium voltage-gated channel subfamily A member 4 antibody, rapidly inactivating potassium channel antibody, Shaker related potassium channel Kv1.4 antibody, shaker-related potassium channel Kv1.4 antibody, type A potassium channel antibody, Voltage gated potassium channel HBK4 antibody, Voltage gated potassium channel HK1 antibody, Voltage gated potassium channel subunit Kv1.4 antibody, Voltage-gated K(+) channel HuKII antibody, voltage-gated potassium channel antibody, Voltage-gated potassium channel HBK4 antibody, Voltage-gated potassium channel HK1 antibody, voltage-gated potassium channel protein Kv1.4 antibody, Voltage-gated potassium channel subunit Kv1.4 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.