LAR polyclonal, anti-human

Quantity: 100 µg

Background:
Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.

Description:
Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase F (PTPRF) detection. Tested with WB, IHC-P in Human.

Synonyms:
FLJ43335 antibody, FLJ45062 antibody, FLJ45567 antibody, LAR antibody, LAR protein antibody, LARFN5C antibody, LARS antibody, LCA homolog antibody, Leukocyte antigen related (LAR) PTP receptor antibody, Leukocyte antigen related antibody, Leukocyte antigen related PTP receptor antibody, Leukocyte antigen related tyrosine phosphatase antibody, Leukocyte common antigen related antibody, Protein Tyrosine Phosphatase Receptor Type F antibody, Protein tyrosine phosphatase receptor type F polypeptide antibody, Ptprf antibody, PTPRF protein antibody, PTPRF_HUMAN antibody, Receptor linked protein tyrosine phosphatase LAR antibody, Receptor type tyrosine protein phosphatase F antibody, Receptor type tyrosine protein phosphatase F precursor antibody, Receptor-type tyrosine-protein phosphatase F antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.