LCAT polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).

Description:
Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase (LCAT) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
LCAT antibody, LCAT_HUMAN antibody, Lecithin cholesterol acyltransferase antibody, Lecithin-cholesterol acyltransferase antibody, Phosphatidylcholine sterol acyltransferase antibody, Phosphatidylcholine-sterol acyltransferase antibody, Phospholipid cholesterol acyltransferase antibody, Phospholipid-cholesterol acyltransferase antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.