Lck polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

Description:
Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck (LCK) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
IMD22 antibody, LCK antibody, Lck p56 antibody, LCK proto-oncogene, Src family tyrosine kinase antibody, LCK_HUMAN antibody, Leukocyte C-terminal Src kinase antibody, LSK antibody, Lymphocyte cell specific protein tyrosine kinase antibody, Lymphocyte cell-specific protein-tyrosine kinase antibody, Lymphocyte specific protein tyrosine kinase antibody, Membrane associated protein tyrosine kinase antibody, Oncogene lck antibody, P56 LCK antibody, p56(LSTRA) protein tyrosine kinase antibody, p56-LCK antibody, p56lck antibody, pp58 lck antibody, pp58lck antibody, Protein YT16 antibody, Proto oncogene tyrosine protein kinase LCK antibody, Proto-oncogene Lck antibody, Protooncogene tyrosine protein kinase LCK antibody, T cell specific protein tyrosine kinase antibody, T cell-specific protein-tyrosine kinase antibody, T lymphocyte specific protein tyrosine kinase p56lck antibody, Tyrosine-protein kinase Lck antibody, YT 16 antibody, YT16 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.