Leptin polyclonal, anti-mouse

Quantity: 100 µg

Background:
Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

Description:
Rabbit IgG polyclonal antibody for Leptin (LEP) detection. Tested with WB, ELISA in Mouse.

Synonyms:
FLJ94114 antibody, LEP antibody, LEP_HUMAN antibody, LEPD antibody, Leptin (murine obesity homolog) antibody, Leptin (obesity homolog, mouse) antibody, Leptin antibody, Leptin Murine Obesity Homolog antibody, Leptin Precursor Obesity Factor antibody, OB antibody, Obese Protein antibody, Obese, mouse, homolog of antibody, Obesity antibody, Obesity factor antibody, Obesity factor antibody, Obesity homolog mouse antibody, Obesity Murine Homolog Leptin antibody, OBS antibody, OTTHUMP00000212285 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse

Applications: WB, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.