LIM Kinase 2 Picoband polyclonal, anti-human, mouse
€455.00
In stock
SKU
AC-ABO12403
Catalog Number: AC-ABO12403
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human;Mouse.Protein Name: LIM domain kinase 2
Protein Function:
Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro. .
Other Names: LIM domain kinase 2, LIMK-2, 2.7.11.1, LIMK2
Subcellular Localization: Isoform LIMK2a: Cytoplasm. Nucleus. Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
Tissue Specificity: Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed. .
Gene ID: 3985
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino a
Calculated MW: 72232
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro. .
Other Names: LIM domain kinase 2, LIMK-2, 2.7.11.1, LIMK2
Subcellular Localization: Isoform LIMK2a: Cytoplasm. Nucleus. Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
Tissue Specificity: Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed. .
Gene ID: 3985
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino a
Calculated MW: 72232
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review