LMO1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10326
Catalog Number: AC-ABO10326
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Rhombotin-1
Protein Function:
May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. .
Other Names: Rhombotin-1, Cysteine-rich protein TTG-1, LIM domain only protein 1, LMO-1, T-cell translocation protein 1, LMO1, RBTN1, RHOM1, TTG1
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed mainly in the central nervous. Low level of expression in other tissues including thymus. .
Gene ID: 4004
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.
Calculated MW: 17828
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. .
Other Names: Rhombotin-1, Cysteine-rich protein TTG-1, LIM domain only protein 1, LMO-1, T-cell translocation protein 1, LMO1, RBTN1, RHOM1, TTG1
Subcellular Localization: Nucleus .
Tissue Specificity: Expressed mainly in the central nervous. Low level of expression in other tissues including thymus. .
Gene ID: 4004
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.
Calculated MW: 17828
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review