LOXL2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.

Description:
Rabbit IgG polyclonal antibody for Lysyl oxidase homolog 2 (LOXL2) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
LOR 2 antibody, LOR2 antibody, LOX L2 antibody, LOXL 2 antibody, LOXL2 antibody, LOXL2_HUMAN antibody, Lysyl oxidase homolog 2 antibody, Lysyl oxidase like 2 antibody, Lysyl oxidase like protein 2 antibody, Lysyl oxidase related 2 antibody, Lysyl oxidase related protein 2 antibody, Lysyl oxidase related protein WS9 14 antibody, Lysyl oxidase-like protein 2 antibody, Lysyl oxidase-related protein 2 antibody, Lysyl oxidase-related protein WS9-14 antibody, WS9 14 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.