LRIG3 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO11695
Catalog Number: AC-ABO11695
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human;Rat.Protein Name: Leucine-rich repeats and immunoglobulin-like domains protein 3
Protein Function:
May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). .
Other Names: Leucine-rich repeats and immunoglobulin-like domains protein 3, LIG-3, LRIG3, LIG3
Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Cytoplasmic vesicle membrane ; Single-pass type I membrane protein . Detected in cytoplasmic vesicles when coexpressed with ERBB4. .
Tissue Specificity: Widely expressed. .
Gene ID: 121227
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
Calculated MW: 123434
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). .
Other Names: Leucine-rich repeats and immunoglobulin-like domains protein 3, LIG-3, LRIG3, LIG3
Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Cytoplasmic vesicle membrane ; Single-pass type I membrane protein . Detected in cytoplasmic vesicles when coexpressed with ERBB4. .
Tissue Specificity: Widely expressed. .
Gene ID: 121227
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
Calculated MW: 123434
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review