MAOB polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
MAOB (MONOAMINE OXIDASE B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

Description:
Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B (MAOB) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Adrenalin oxidase antibody, Amine oxidase (flavin containing) antibody, Amine oxidase [flavin-containing] B antibody, AOFB_HUMAN antibody, HGNC:6834 antibody, MAO, brain antibody, MAO, platelet antibody, MAO-B antibody, MAOB antibody, MGC26382 antibody, Monoamine oxidase B antibody, Monoamine oxidase type B antibody, OTTHUMP00000023166 antibody, RP1 201D17__B.1 antibody, Tyramine oxidase antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.