MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) (clone 2F6), anti-human
€0.00
In stock
SKU
ARP-24-4214-MSM1
Catalog Number: 24-4214-MSM1
Size: 100 µl, 0.5 ml, 1 ml
Isotype: Mouse IgG2a, kappa
Size: 100 µl, 0.5 ml, 1 ml
Isotype: Mouse IgG2a, kappa
Decription:
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFĪŗB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Synonyms: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1
Clone: 2F6
Isotype: Mouse IgG2a, kappa
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Reactivity: human. Others not known.
Form: Purified, in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Applications: Flow Cytometry (0.5-1ug/million cells in 0.1ml)
Immunofluorescence (1-2ug/ml)
Western Blotting (0.5-1ug/ml)
Immunohistology (Formalin-fixed) (0.5-1ug/ml for 30 minutes at RT)
(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.
Reactivity: A431, HeLa or HL-60 cells or liver tissue.
Concentration: 0.2mg/ml
Storage: Can be stored at +4C. For long term storage, aliquot and store at -20C. Avoid repeated freezing and thawing cycles.
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFĪŗB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Synonyms: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1
Clone: 2F6
Isotype: Mouse IgG2a, kappa
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Reactivity: human. Others not known.
Form: Purified, in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Applications: Flow Cytometry (0.5-1ug/million cells in 0.1ml)
Immunofluorescence (1-2ug/ml)
Western Blotting (0.5-1ug/ml)
Immunohistology (Formalin-fixed) (0.5-1ug/ml for 30 minutes at RT)
(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.
Reactivity: A431, HeLa or HL-60 cells or liver tissue.
Concentration: 0.2mg/ml
Storage: Can be stored at +4C. For long term storage, aliquot and store at -20C. Avoid repeated freezing and thawing cycles.
| Is Featured? | No |
|---|
Write Your Own Review