MC2 receptor Picoband polyclonal, anti-human, mouse
€455.00
In stock
SKU
AC-ABO10241
Catalog Number: AC-ABO10241
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Adrenocorticotropic hormone receptor(MC2R) detection. Tested with WB in Human;Mouse.Protein Name: Adrenocorticotropic hormone receptor
Protein Function:
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP). .
Other Names: Adrenocorticotropic hormone receptor, ACTH receptor, ACTH-R, Adrenocorticotropin receptor, Melanocortin receptor 2, MC2-R, MC2R, ACTHR
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Melanocytes and corticoadrenal tissue.
Gene ID: 4158
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
Calculated MW: 33927
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP). .
Other Names: Adrenocorticotropic hormone receptor, ACTH receptor, ACTH-R, Adrenocorticotropin receptor, Melanocortin receptor 2, MC2-R, MC2R, ACTHR
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Melanocytes and corticoadrenal tissue.
Gene ID: 4158
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
Calculated MW: 33927
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review