MC3 Receptor Picoband polyclonal, anti-human, mouse
€455.00
In stock
SKU
AC-ABO10263
Catalog Number: AC-ABO10263
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection. Tested with WB in Human;Mouse.Protein Name: Melanocortin receptor 3
Protein Function:
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain. .
Other Names: Melanocortin receptor 3, MC3-R, MC3R
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Brain, placental, and gut tissues.
Gene ID: 4159
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 36043
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain. .
Other Names: Melanocortin receptor 3, MC3-R, MC3R
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Brain, placental, and gut tissues.
Gene ID: 4159
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 36043
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review