MCM8 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12408
Catalog Number: AC-ABO12408
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.Protein Name: DNA helicase MCM8
Protein Function:
Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8- MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. .
Other Names: DNA helicase MCM8, 3.6.4.12, Minichromosome maintenance 8, MCM8, C20orf154
Subcellular Localization: Nucleus . Localizes to nuclear foci and colocalizes with RAD51.
Tissue Specificity: Highest levels in placenta, lung and pancreas. Low levels in skeletal muscle and kidney. Expressed in various tumors with highest levels in colon and lung cancers. .
Gene ID: 84515
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 93697
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8- MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. .
Other Names: DNA helicase MCM8, 3.6.4.12, Minichromosome maintenance 8, MCM8, C20orf154
Subcellular Localization: Nucleus . Localizes to nuclear foci and colocalizes with RAD51.
Tissue Specificity: Highest levels in placenta, lung and pancreas. Low levels in skeletal muscle and kidney. Expressed in various tumors with highest levels in colon and lung cancers. .
Gene ID: 84515
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 93697
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review