MDMX polyclonal, anti-human, mouse

Quantity: 100 µg

Background:
Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. 

Description:
Rabbit IgG polyclonal antibody for Protein Mdm4 (MDM4) detection. Tested with WB, IHC-P in Human, Mouse.

Synonyms:
DKFZp781B1423 antibody, Double minute 4 antibody, Double minute 4 human homolog of p53 binding protein antibody, Double minute 4 protein antibody, HDMX antibody, MDM 4 antibody, Mdm2 like p53 binding protein antibody, Mdm2-like p53-binding protein antibody, MDM4 antibody, Mdm4 p53 binding protein homolog mouse antibody, Mdm4 protein antibody, MDM4 related protein 1 antibody, Mdm4 transformed 3T3 cell double minute 4 antibody, Mdm4 transformed 3T3 cell double minute 4 p53 binding protein antibody, Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse antibody, MDM4_HUMAN antibody, Mdmx protein antibody, MGC132766 antibody, Mouse double minute 4 homolog antibody, Mouse double minute 4 human homolog of p53 binding protein antibody, MRP 1 antibody, MRP1 antibody, p53 binding protein antibody, p53 BINDING PROTEIN MDM4 antibody, p53-binding protein Mdm4 antibody, Protein Mdm4 antibody, Protein Mdmx antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.