MEIS1 polyclonal, anti-mouse, rat, human

Quantity: 100 µg

Background:
Homeobox protein Meis1 is a protein that in humans is encoded by the MEIS1 gene. Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia: PPX1, HOXA10, and HOXB8 play important roles in leukemia. This gene is mapped to chromosome 2p14-p13. The Meis1 locus is isolated as a common site of viral integration involved in myeloid leukemia in BXH-2 mice. MEIS1 encodes a novel homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. The homeodomain of MEIS1 is the only conserved motif within the entire 390-amino acid protein.

Description:
Rabbit IgG polyclonal antibody for Homeobox protein Meis1 (MEIS1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Homeo box protein Meis1 antibody, Homeobox protein Meis1 antibody, Leukemogenic homolog protein antibody, MEIS 1 antibody, Meis homeo box 1 antibody, Meis homeobox 1 antibody, Meis1 antibody, Meis1 mouse homolog antibody, Meis1 myeloid ecotropic viral integration site 1 homolog antibody, Meis1 myeloid ecotropic viral integration site 1 homolog mouse antibody, MEIS1 protein antibody, MEIS1_HUMAN antibody, MGC43380 antibody, Myeloid ecotropic viral integration site 1 homolog antibody, WUGSC:H NH0444B04.1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human MEIS1 (26-60aa DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the N-terminus of human MEIS1 (26-60aa DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.