MEK3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12449
Catalog Number: AC-ABO12449
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
Protein Function:
Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38.
Other Names: Dual specificity mitogen-activated protein kinase kinase 3, MAP kinase kinase 3, MAPKK 3, 2.7.12.2, MAPK/ERK kinase 3, MEK 3, Stress-activated protein kinase kinase 2, SAPK kinase 2, SAPKK-2, SAPKK2, MAP2K3, MEK3, MKK3, PRKMK3, SKK2
Tissue Specificity: Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
Gene ID: 5606
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
Calculated MW: 39318
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38.
Other Names: Dual specificity mitogen-activated protein kinase kinase 3, MAP kinase kinase 3, MAPKK 3, 2.7.12.2, MAPK/ERK kinase 3, MEK 3, Stress-activated protein kinase kinase 2, SAPK kinase 2, SAPKK-2, SAPKK2, MAP2K3, MEK3, MKK3, PRKMK3, SKK2
Tissue Specificity: Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
Gene ID: 5606
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
Calculated MW: 39318
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review