MGST1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1 (MGST1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
MGST1 antibody, Glutathione S transferase 12 antibody, GST12 antibody, MGST 1 antibody, MGST antibody, MGST1 antibody, MGST1_HUMAN antibody, Microsomal glutathione S-transferase 1 antibody, Microsomal GST 1 antibody, Microsomal GST-1 antibody, Microsomal GST-I antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.