MICA polyclonal, anti-human

Quantity: 100 µg

Background:
This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants.

Description:
Rabbit IgG polyclonal antibody for MHC class I polypeptide-related sequence A (MICA) detection. Tested with WB in Human.

Synonyms:
HLA class I antigen antibody, FLJ36918 antibody, FLJ60820 antibody, MGC111087 antibody, MGC21250 antibody, MHC class I chain related gene A protein antibody, MHC class I chain related protein A antibody, MHC class I chain related protein A HLA B HLA C antibody, MHC class I polypeptide related sequence A antibody, MHC class I polypeptide-related sequence A antibody, MHC class I related protein antibody, MIC A antibody, MIC-A antibody, micA antibody, MICA_HUMAN antibody, OTTHUMP00000029088 antibody, OTTHUMP00000044528 antibody, OTTHUMP00000165170 antibody, OTTHUMP00000165172 antibody, PERB11.1 antibody, Stress inducible class I homolog antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.