MLH1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.

Description:
Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1 (MLH1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
COCA 2 antibody, COCA2 antibody, DNA mismatch repair protein Mlh1 antibody, FCC 2 antibody, FCC2 antibody, hMLH 1 antibody, hMLH1 antibody, HNPCC 2 antibody, HNPCC antibody, HNPCC2 antibody, MGC5172 antibody, MLH 1 antibody, MLH1 antibody, MLH1_HUMAN antibody, MutL homolog 1 (E. coli) antibody, MutL homolog 1 antibody, MutL homolog 1 colon cancer nonpolyposis type 2 antibody, MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) antibody, MutL protein homolog 1 antibody, MutL, E. coli, homolog of, 1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.