MMP-12 polyclonal, anti-mouse
€455.00
In stock
SKU
AC-ABO12766
Catalog Number: AC-ABO12766
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.Protein Name: Macrophage metalloelastase
Protein Function:
May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3 (By similarity). .
Other Names: Macrophage metalloelastase, MME, 3.4.24.65, Matrix metalloproteinase-12, MMP-12, Mmp12, Mme, Mmel
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Gene ID: 17381
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.
Calculated MW: 54971
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3 (By similarity). .
Other Names: Macrophage metalloelastase, MME, 3.4.24.65, Matrix metalloproteinase-12, MMP-12, Mmp12, Mme, Mmel
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Gene ID: 17381
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.
Calculated MW: 54971
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review